HPA023092

EFR3A antibody from Atlas Antibodies
KIAA0143
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023092
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023092, RRID:AB_2293240
Product name
Anti-EFR3A
Provider product page
Atlas Antibodies - HPA023092
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYE
LRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLK
IKREKICRQDTSFMK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -