HPA022859

EFR3A antibody from Sigma-Aldrich
KIAA0143
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022859, RRID:AB_1848029
Product name
Anti-EFR3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022859
Antibody type
Polyclonal
Antigen
Protein EFR3 homolog A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEI
MMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIML
L
Storage
-20C
Provider Type Product Number
- No reagents -