Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003310 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003310, RRID:AB_1080413
- Product name
- Anti-TTC8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQE
GIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQ
AVRPITQAGRPITGFLRPSTQSGRPGTMEQAI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Photoreceptor cilia, in contrast to primary cilia, grant entry to a partially assembled BBSome
The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors
BBSome function is required for both the morphogenesis and maintenance of the photoreceptor outer segment
BBS4 and BBS5 show functional redundancy in the BBSome to regulate the degradative sorting of ciliary sensory receptors
Essential Role of the Chaperonin CCT in Rod Outer Segment Biogenesis
BBS mutations modify phenotypic expression of CEP290-related ciliopathies
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
Hsu Y, Seo S, Sheffield V
Human Molecular Genetics 2021;30(1):87-102
Human Molecular Genetics 2021;30(1):87-102
The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors
Datta P, Hendrickson B, Brendalen S, Ruffcorn A, Seo S
Journal of Biological Chemistry 2019;294(50):19119-19136
Journal of Biological Chemistry 2019;294(50):19119-19136
BBSome function is required for both the morphogenesis and maintenance of the photoreceptor outer segment
Barsh G, Hsu Y, Garrison J, Kim G, Schmitz A, Searby C, Zhang Q, Datta P, Nishimura D, Seo S, Sheffield V
PLOS Genetics 2017;13(10):e1007057
PLOS Genetics 2017;13(10):e1007057
BBS4 and BBS5 show functional redundancy in the BBSome to regulate the degradative sorting of ciliary sensory receptors
Xu Q, Zhang Y, Wei Q, Huang Y, Li Y, Ling K, Hu J
Scientific Reports 2015;5(1)
Scientific Reports 2015;5(1)
Essential Role of the Chaperonin CCT in Rod Outer Segment Biogenesis
Sinha S, Belcastro M, Datta P, Seo S, Sokolov M
Investigative Opthalmology & Visual Science 2014;55(6):3775
Investigative Opthalmology & Visual Science 2014;55(6):3775
BBS mutations modify phenotypic expression of CEP290-related ciliopathies
Zhang Y, Seo S, Bhattarai S, Bugge K, Searby C, Zhang Q, Drack A, Stone E, Sheffield V
Human Molecular Genetics 2014;23(1):40-51
Human Molecular Genetics 2014;23(1):40-51
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
Dutcher S, Chamling X, Seo S, Searby C, Kim G, Slusarski D, Sheffield V
PLoS Genetics 2014;10(2):e1004083
PLoS Genetics 2014;10(2):e1004083
No comments: Submit comment
No validations: Submit validation data