Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003310 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003310, RRID:AB_1080413
- Product name
- Anti-TTC8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQE
GIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQ
AVRPITQAGRPITGFLRPSTQSGRPGTMEQAI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references BBS4 and BBS5 show functional redundancy in the BBSome to regulate the degradative sorting of ciliary sensory receptors.
Essential role of the chaperonin CCT in rod outer segment biogenesis.
BBS mutations modify phenotypic expression of CEP290-related ciliopathies.
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
Xu Q, Zhang Y, Wei Q, Huang Y, Li Y, Ling K, Hu J
Scientific reports 2015 Jul 7;5:11855
Scientific reports 2015 Jul 7;5:11855
Essential role of the chaperonin CCT in rod outer segment biogenesis.
Sinha S, Belcastro M, Datta P, Seo S, Sokolov M
Investigative ophthalmology & visual science 2014 May 22;55(6):3775-85
Investigative ophthalmology & visual science 2014 May 22;55(6):3775-85
BBS mutations modify phenotypic expression of CEP290-related ciliopathies.
Zhang Y, Seo S, Bhattarai S, Bugge K, Searby CC, Zhang Q, Drack AV, Stone EM, Sheffield VC
Human molecular genetics 2014 Jan 1;23(1):40-51
Human molecular genetics 2014 Jan 1;23(1):40-51
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
Chamling X, Seo S, Searby C, Kim G, Slusarski D, Sheffield V, Dutcher S
PLoS Genetics 2014 February;10(2)
PLoS Genetics 2014 February;10(2)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.