HPA019034

MOV10L1 antibody from Sigma-Aldrich
CHAMP, DJ402G11.8, DKFZp434B0717
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019034
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019034, RRID:AB_1854070
Product name
Anti-MOV10L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019034
Antibody type
Polyclonal
Antigen
Putative helicase Mov10l1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEF
TYNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSP
QVTGNWNHAQDTKSSGQSTSKKNRKTMTDQ
Storage
-20C
Provider Type Product Number
- No reagents -