Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008736 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008736, RRID:AB_1078625
- Product name
- Anti-DAXX
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQIS
RSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGE
QPEELTLEEESPVSQLFELEIEALPLDTPSSVETD
ISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPH
NWGDSG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast
ATRX represses alternative lengthening of telomeres
Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours.
Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas.
Sp100 Provides Intrinsic Immunity against Human Papillomavirus Infection
Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors.
Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma
Altered Telomeres in Tumors with ATRX and DAXX Mutations
Yoshida M, Ogawa R, Yoshida H, Maeshima A, Kanai Y, Kinoshita T, Hiraoka N, Sekine S
British Journal of Cancer 2015 September;113(8):1244-1248
British Journal of Cancer 2015 September;113(8):1244-1248
ATRX represses alternative lengthening of telomeres
Napier C, Huschtscha L, Harvey A, Bower K, Noble J, Hendrickson E, Reddel R
Oncotarget 2015 June;6(18):16543-16558
Oncotarget 2015 June;6(18):16543-16558
Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours.
Pipinikas CP, Dibra H, Karpathakis A, Feber A, Novelli M, Oukrif D, Fusai G, Valente R, Caplin M, Meyer T, Teschendorff A, Bell C, Morris TJ, Salomoni P, Luong TV, Davidson B, Beck S, Thirlwell C
Endocrine-related cancer 2015 Jun;22(3):L13-8
Endocrine-related cancer 2015 Jun;22(3):L13-8
Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas.
Fishbein L, Khare S, Wubbenhorst B, DeSloover D, D'Andrea K, Merrill S, Cho NW, Greenberg RA, Else T, Montone K, LiVolsi V, Fraker D, Daber R, Cohen DL, Nathanson KL
Nature communications 2015 Jan 21;6:6140
Nature communications 2015 Jan 21;6:6140
Sp100 Provides Intrinsic Immunity against Human Papillomavirus Infection
Stepp W, Meyers J, McBride A
mBio 2013 October;4(6)
mBio 2013 October;4(6)
Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors.
de Wilde RF, Heaphy CM, Maitra A, Meeker AK, Edil BH, Wolfgang CL, Ellison TA, Schulick RD, Molenaar IQ, Valk GD, Vriens MR, Borel Rinkes IH, Offerhaus GJ, Hruban RH, Matsukuma KE
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 Jul;25(7):1033-9
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 Jul;25(7):1033-9
Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma
Schwartzentruber J, Korshunov A, Liu X, Jones D, Pfaff E, Jacob K, Sturm D, Fontebasso A, Quang D, Tönjes M, Hovestadt V, Albrecht S, Kool M, Nantel A, Konermann C, Lindroth A, Jäger N, Rausch T, Ryzhova M, Korbel J, Hielscher T, Hauser P, Garami M, Klekner A, Bognar L, Ebinger M, Schuhmann M, Scheurlen W, Pekrun A, Frühwald M, Roggendorf W, Kramm C, Dürken M, Atkinson J, Lepage P, Montpetit A, Zakrzewska M, Zakrzewski K, Liberski P, Dong Z, Siegel P, Kulozik A, Zapatka M, Guha A, Malkin D, Felsberg J, Reifenberger G, von Deimling A, Ichimura K, Collins V, Witt H, Milde T, Witt O, Zhang C, Castelo-Branco P, Lichter P, Faury D, Tabori U, Plass C, Majewski J, Pfister S, Jabado N
Nature 2012 January;482(7384):226-231
Nature 2012 January;482(7384):226-231
Altered Telomeres in Tumors with ATRX and DAXX Mutations
Heaphy C, de Wilde R, Jiao Y, Klein A, Edil B, Shi C, Bettegowda C, Rodriguez F, Eberhart C, Hebbar S, Offerhaus G, McLendon R, Rasheed B, He Y, Yan H, Bigner D, Oba-Shinjo S, Marie S, Riggins G, Kinzler K, Vogelstein B, Hruban R, Maitra A, Papadopoulos N, Meeker A
Science 2011 July;333(6041):425-425
Science 2011 July;333(6041):425-425
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DAXX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and DAXX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY427987).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA008736 antibody. Corresponding DAXX RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN