HPA008736

DAXX antibody from Atlas Antibodies
DAP6
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA008736
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008736, RRID:AB_1078625
Product name
Anti-DAXX
Provider product page
Atlas Antibodies - HPA008736
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQIS
RSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGE
QPEELTLEEESPVSQLFELEIEALPLDTPSSVETD
ISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPH
NWGDSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -