HPA001407

RABGEF1 antibody from Sigma-Aldrich
rabex-5, RABEX5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001407
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001407, RRID:AB_1856024
Product name
Anti-RABGEF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001407
Antibody type
Polyclonal
Antigen
RAB guanine nucleotide exchange factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYK
RDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVE
KIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQK
RIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDI
IEMDSKRVP
Storage
-20C
Provider Type Product Number
- No reagents -