Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029127-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029127-M01, RRID:AB_464234
- Product name
- RACGAP1 monoclonal antibody (M01), clone 1G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
- Antigen sequence
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAK
DFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIRE
MLMCD- Isotype
- IgG
- Antibody clone number
- 1G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Centralspindlin links the mitotic spindle to the plasma membrane during cytokinesis.
Upregulation of Rac GTPase-activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma.
Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
Lekomtsev S, Su KC, Pye VE, Blight K, Sundaramoorthy S, Takaki T, Collinson LM, Cherepanov P, Divecha N, Petronczki M
Nature 2012 Dec 13;492(7428):276-9
Nature 2012 Dec 13;492(7428):276-9
Upregulation of Rac GTPase-activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma.
Wang SM, Ooi LL, Hui KM
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Sep 15;17(18):6040-51
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Sep 15;17(18):6040-51
Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
Burkard ME, Maciejowski J, Rodriguez-Bravo V, Repka M, Lowery DM, Clauser KR, Zhang C, Shokat KM, Carr SA, Yaffe MB, Jallepalli PV
PLoS biology 2009 May 5;7(5):e1000111
PLoS biology 2009 May 5;7(5):e1000111
Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
Wolfe BA, Takaki T, Petronczki M, Glotzer M
PLoS biology 2009 May 5;7(5):e1000110
PLoS biology 2009 May 5;7(5):e1000110
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RACGAP1 monoclonal antibody (M01), clone 1G6. Western Blot analysis of RACGAP1 expression in 293 ( Cat # L026V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RACGAP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol