HPA004775

HDAC7 antibody from Sigma-Aldrich
DKFZP586J0917, HDAC7A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004775
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004775, RRID:AB_1850548
Product name
Anti-HDAC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004775
Antibody type
Polyclonal
Antigen
Histone deacetylase 7a recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSK
RSAVASSVVKQKLAEVILKKQQAALERTVHPNSPG
IPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPE
HFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRK
Storage
-20C
Provider Type Product Number
- No reagents -