HPA012285

INPP5A antibody from Sigma-Aldrich
5PTASE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012285, RRID:AB_1851802
Product name
Anti-INPP5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012285
Antibody type
Polyclonal
Antigen
Type I inositol-1,4,5-trisphosphate 5-phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRD
NNGTALLEFDKELSVFKDRLYELDISFPPSYPYSE
DARQGEQYMNTRCPAWCDRILMSPSAKELVLRSES
EEKVVTYDHIGPNVCMGDHKPVFL
Storage
-20C
Provider Type Product Number
- No reagents -