HPA028058

LRRC6 antibody from Atlas Antibodies
CILD19, LRTP, tilB, TSLRP

Antibody data

Product number
HPA028058
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028058, RRID:AB_1853337
Product name
Anti-LRRC6
Provider product page
Atlas Antibodies - HPA028058
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSRE
QTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTP
RRRPEPKIIPSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.