H00023639-B01

LRRC6 antibody from Abnova Corporation
CILD19, LRTP, TSLRP

Antibody data

Product number
H00023639-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023639-B01, RRID:AB_1204633
Product name
LRRC6 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023639-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LRRC6 protein.
Antigen sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIER
LEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEY
LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSS
IKNLQHNIHLKELFLMGNPCASFDHYREFVVATLP
QLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKD
HCLKRAKLKEEAQRKHQEEDKNEDKRSNAGFDGRW
YTDINATLSSLESKDHLQAPDTEEHNTKKLDNSED
DLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSE
KKKKVKPPRTLITEDGKALNVNEPKIDFSLKDNEK
QIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPF
QLVLPAEVKPDSSSAKRSQTTGHLVICMPKVGEVI
TGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPT
FEDNPEVPPLI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -