HPA021640

LRRC6 antibody from Sigma-Aldrich
CILD19, LRTP, TSLRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021640, RRID:AB_1853335
Product name
Anti-LRRC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021640
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KIENVSKLKKLEYLNLALNNIEKIENLEGCEELAK
LDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCAS
FDHYREFVVATLPQLKWLDGKEI
Storage
-20C
Provider Type Product Number
- No reagents -