HPA004201

DAZAP1 antibody from Atlas Antibodies
MGC19907
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004201
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004201, RRID:AB_888325
Product name
Anti-DAZAP1
Provider product page
Atlas Antibodies - HPA004201
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPP
PTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPP
PPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFG
YGPPPPPPDQFAPPGVPPPPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -