HPA004631

DAZAP1 antibody from MilliporeSigma / Merck KGaA
MGC19907
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004631
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA004631, RRID:AB_1078626
Product name
Anti-DAZAP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA004631
Antibody type
Polyclonal
Antigen
DAZ-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFG
FVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRG
MQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNC
GETELREYFKKFGVVTEVVMIYDAEKQRPR
Storage
-20C
Provider Type Product Number
- No reagents -