HPA004817

FOSL2 antibody from Sigma-Aldrich
FLJ23306, FRA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004817, RRID:AB_1849014
Product name
Anti-FOSL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004817
Antibody type
Polyclonal
Antigen
Fos-related antigen 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSG
GGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIK
PISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVF
TYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDS
L
Storage
-20C
Provider Type Product Number
- No reagents -