Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022479 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA022479, RRID:AB_1853521
- Product name
- Anti-SPAG5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KSGELISLREEVTHLTRSLRRAETETKVLQEALAG
QLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMK
NEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIV
QHIYKTLLSIPEVVRGCKELQGLLEF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Association of Sperm-Associated Antigen 5 and Treatment Response in Patients With Estrogen Receptor–Positive Breast Cancer
SPAG5 is associated with unfavorable prognosis in patients with lung adenocarcinoma and promotes proliferation, motility and autophagy in A549 cells
miR-539 inhibits prostate cancer progression by directly targeting SPAG5
Abdel-Fatah T, Ball G, Thangavelu P, Reid L, McCart Reed A, Saunus J, Duijf P, Simpson P, Lakhani S, Pongor L, Gyorffy B, Moseley P, Green A, Pockley A, Caldas C, Ellis I, Chan S
JAMA Network Open 2020;3(7):e209486
JAMA Network Open 2020;3(7):e209486
SPAG5 is associated with unfavorable prognosis in patients with lung adenocarcinoma and promotes proliferation, motility and autophagy in A549 cells
Huang R, Li A
Experimental and Therapeutic Medicine 2020;20(5):1-1
Experimental and Therapeutic Medicine 2020;20(5):1-1
miR-539 inhibits prostate cancer progression by directly targeting SPAG5
Zhang H, Li S, Yang X, Qiao B, Zhang Z, Xu Y
Journal of Experimental & Clinical Cancer Research 2016;35(1)
Journal of Experimental & Clinical Cancer Research 2016;35(1)
No comments: Submit comment
No validations: Submit validation data