HPA022479

SPAG5 antibody from Sigma-Aldrich
DEEPEST, hMAP126, MAP126
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022479
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022479, RRID:AB_1853521
Product name
Anti-SPAG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022479
Antibody type
Polyclonal
Antigen
Sperm-associated antigen 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSGELISLREEVTHLTRSLRRAETETKVLQEALAG
QLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMK
NEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIV
QHIYKTLLSIPEVVRGCKELQGLLEF
Storage
-20C
Provider Type Product Number
- No reagents -