HPA004818

MCM6 antibody from Atlas Antibodies
Mis5
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004818, RRID:AB_1079339
Product name
Anti-MCM6
Provider product page
Atlas Antibodies - HPA004818
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTP
GARAETNSRVSGVDGYETEGIRGLRALGVRDLSYR
LVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMT
VKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVK
RGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -