HPA004818

MCM6 antibody from Atlas Antibodies
Mis5
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004818, RRID:AB_888345
Product name
Anti-MCM6
Provider product page
Atlas Antibodies - HPA004818
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTP
GARAETNSRVSGVDGYETEGIRGLRALGVRDLSYR
LVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMT
VKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVK
RGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -