HPA004818

MCM6 antibody from Sigma-Aldrich
Mis5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004818
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004818, RRID:AB_1079339
Product name
Anti-MCM6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004818
Antibody type
Polyclonal
Antigen
DNA replication licensing factor MCM6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTP
GARAETNSRVSGVDGYETEGIRGLRALGVRDLSYR
LVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMT
VKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVK
RGV
Storage
-20C
Provider Type Product Number
- No reagents -