Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310389 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pannexin 2 (PANX2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PANX2 antibody: synthetic peptide directed towards the N terminal of human PANX2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQ
ALYAR GYCWTELRDA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of a pannexin 2-pannexin 1 chimeric protein supports divergent roles for pannexin C-termini in cellular localization.
Hippocampal seizures alter the expression of the pannexin and connexin transcriptome.
Pannexin 2 is expressed by postnatal hippocampal neural progenitors and modulates neuronal commitment.
Identification and characterization of pannexin expression in the mammalian cochlea.
Pannexin2 as a novel growth regulator in C6 glioma cells.
The mammalian pannexin family is homologous to the invertebrate innexin gap junction proteins.
Wicki-Stordeur LE, Boyce AK, Swayne LA
Cell communication & adhesion 2013 Aug;20(3-4):73-9
Cell communication & adhesion 2013 Aug;20(3-4):73-9
Hippocampal seizures alter the expression of the pannexin and connexin transcriptome.
Mylvaganam S, Zhang L, Wu C, Zhang ZJ, Samoilova M, Eubanks J, Carlen PL, Poulter MO
Journal of neurochemistry 2010 Jan;112(1):92-102
Journal of neurochemistry 2010 Jan;112(1):92-102
Pannexin 2 is expressed by postnatal hippocampal neural progenitors and modulates neuronal commitment.
Swayne LA, Sorbara CD, Bennett SA
The Journal of biological chemistry 2010 Aug 6;285(32):24977-86
The Journal of biological chemistry 2010 Aug 6;285(32):24977-86
Identification and characterization of pannexin expression in the mammalian cochlea.
Wang XH, Streeter M, Liu YP, Zhao HB
The Journal of comparative neurology 2009 Jan 20;512(3):336-46
The Journal of comparative neurology 2009 Jan 20;512(3):336-46
Pannexin2 as a novel growth regulator in C6 glioma cells.
Lai CP, Bechberger JF, Naus CC
Oncogene 2009 Dec 10;28(49):4402-8
Oncogene 2009 Dec 10;28(49):4402-8
The mammalian pannexin family is homologous to the invertebrate innexin gap junction proteins.
Baranova A, Ivanov D, Petrash N, Pestova A, Skoblov M, Kelmanson I, Shagin D, Nazarenko S, Geraymovych E, Litvin O, Tiunova A, Born TL, Usman N, Staroverov D, Lukyanov S, Panchin Y
Genomics 2004 Apr;83(4):706-16
Genomics 2004 Apr;83(4):706-16
No comments: Submit comment
No validations: Submit validation data