WH0008028M1

MLLT10 antibody from Sigma-Aldrich
AF10
ELISA
Recommended by provider

Antibody data

Product number
WH0008028M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0008028M1, RRID:AB_1842491
Product name
Monoclonal Anti-MLLT10 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0008028M1
Antibody type
Monoclonal
Antigen
MLLT10 (NP_001009569, a.a. 695-794) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQ
FLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNL
TAKKERLQLLNAQLSVPFPTITANPSPSH* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -