Antibody data

Product number
H00008028-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008028-M01, RRID:AB_606592
Product name
MLLT10 monoclonal antibody (M01), clone 6H8
Provider product page
Abnova Corporation - H00008028-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MLLT10.
Antigen sequence
QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQ
FLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNL
TAKKERLQLLNAQLSVPFPTITANPSPSH
Isotype
IgG
Antibody clone number
6H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -