HPA005747

MLLT10 antibody from Atlas Antibodies
AF10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005747
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005747, RRID:AB_888776
Product name
Anti-MLLT10
Provider product page
Atlas Antibodies - HPA005747
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHS
QQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSA
VTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEE
ETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSV
SSASPTSSV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -