HPA005747

MLLT10 antibody from Sigma-Aldrich
AF10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005747
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005747, RRID:AB_1079393
Product name
Anti-MLLT10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005747
Antibody type
Polyclonal
Antigen
Protein AF-10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHS
QQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSA
VTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEE
ETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSV
SSASPTSSV
Storage
-20C
Provider Type Product Number
- No reagents -