Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502440 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 43, Member 1 (SLC43A1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC43A1 antibody: synthetic peptide directed towards the middle region of human SLC43A1
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSV
FGAMQ LLCLLTCPLI- Vial size
- 50 µg
- Storage
- Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters.
Babu E, Kanai Y, Chairoungdua A, Kim DK, Iribe Y, Tangtrongsup S, Jutabha P, Li Y, Ahmed N, Sakamoto S, Anzai N, Nagamori S, Endou H
The Journal of biological chemistry 2003 Oct 31;278(44):43838-45
The Journal of biological chemistry 2003 Oct 31;278(44):43838-45
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting