HPA018813

SLC43A1 antibody from Sigma-Aldrich
PB39, POV1, R00504
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018813, RRID:AB_1857164
Product name
Anti-SLC43A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018813
Antibody type
Polyclonal
Antigen
Large neutral amino acids transporter small subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYC
KIQ
Storage
-20C
Provider Type Product Number
- No reagents -