HPA018813

SLC43A1 antibody from Atlas Antibodies
PB39, POV1, R00504
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018813
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018813, RRID:AB_1235667
Product name
Anti-SLC43A1
Provider product page
Atlas Antibodies - HPA018813
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYC
KIQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -