HPA018813

SLC43A1 antibody from Atlas Antibodies
PB39, POV1, R00504
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018813
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018813, RRID:AB_1857164
Product name
Anti-SLC43A1
Provider product page
Atlas Antibodies - HPA018813
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYC
KIQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -