Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501611 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-LAG1 Homolog, Ceramide Synthase 5 (LASS5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKK
RLEGL SKQLDWNVRK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Protein kinase C-induced activation of a ceramide/protein phosphatase 1 pathway leading to dephosphorylation of p38 MAPK.
Kitatani K, Idkowiak-Baldys J, Bielawski J, Taha TA, Jenkins RW, Senkal CE, Ogretmen B, Obeid LM, Hannun YA
The Journal of biological chemistry 2006 Dec 1;281(48):36793-802
The Journal of biological chemistry 2006 Dec 1;281(48):36793-802
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting