HPA026589

CERS5 antibody from MilliporeSigma / Merck KGaA
FLJ25304, LASS5, MGC45411, Trh4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026589
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026589, RRID:AB_1852727
Product name
Anti-LASS5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026589
Antibody type
Polyclonal
Antigen
LAG1 longevity assurance homolog 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPLSLLWGWLWSERFWLPENVSWADLEGPADGYGY
Storage
-20C
Provider Type Product Number
- No reagents -