Antibody data

Product number
PAB20847
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20847, RRID:AB_10963628
Product name
ZNF367 polyclonal antibody
Provider product page
Abnova Corporation - PAB20847
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF367.
Antigen sequence
RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWL
ARYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQS
DEEDDEKRGAQRRLQEQRERLHGALALIELANLTG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -