HPA015785

ZNF367 antibody from Sigma-Aldrich
FLJ33970
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015785
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015785, RRID:AB_2217750
Product name
Anti-ZNF367 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015785
Antibody type
Polyclonal
Antigen
Zinc finger protein 367 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWL
ARYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQS
DEEDDEKRGAQRRLQEQRERLHGALALIELANLTG
Storage
-20C
Provider Type Product Number
- No reagents -