HPA005737

CNOT4 antibody from Atlas Antibodies
CLONE243, NOT4, NOT4H
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005737
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005737, RRID:AB_1078544
Product name
Anti-CNOT4
Provider product page
Atlas Antibodies - HPA005737
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWP
TAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPE
DDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTS
LQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFS
VLPQRF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -