HPA005737

CNOT4 antibody from Sigma-Aldrich
CLONE243, NOT4, NOT4H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005737
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005737, RRID:AB_1078544
Product name
Anti-CNOT4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005737
Antibody type
Polyclonal
Antigen
CCR4-NOT transcription complex subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWP
TAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPE
DDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTS
LQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFS
VLPQRF
Storage
-20C
Provider Type Product Number
- No reagents -