H00007321-M01
antibody from Abnova Corporation
Targeting: UBE2D1
E2(17)KB1, SFT, UBC4/5, UBCH5, UbcH5A
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007321-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007321-M01, RRID:AB_607263
- Product name
- UBE2D1 monoclonal antibody (M01), clone 2C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBE2D1.
- Antigen sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQA
TIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT
TKIYHPNINSNGSICLDILRSQWS- Isotype
- IgG
- Antibody clone number
- 2C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The stability of herpes simplex virus 1 ICP0 early after infection is defined by the RING finger and the UL13 protein kinase.
Zhu Z, Du T, Zhou G, Roizman B
Journal of virology 2014 May;88(10):5437-43
Journal of virology 2014 May;88(10):5437-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6.Lane 1: UBE2D1 transfected lysate(16.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol