HPA005559

CCNT2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005559
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005559, RRID:AB_1078608
Product name
Anti-CCNT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005559
Antibody type
Polyclonal
Antigen
Cyclin-T2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLET
LDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPI
KMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKS
ASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPH
Storage
-20C
Provider Type Product Number
- No reagents -