HPA023871

LIMA1 antibody from Sigma-Aldrich
EPLIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023871, RRID:AB_1852875
Product name
Anti-LIMA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023871
Antibody type
Polyclonal
Antigen
LIM domain and actin-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLE
LPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKA
SGGEIKIHKMEQKENVPPGPEVCITHQEGEKISAN
ENSLAVRSTPAEDDSRDS
Storage
-20C
Provider Type Product Number
- No reagents -