Antibody data

Product number
H00009441-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009441-M06, RRID:AB_1112312
Product name
CRSP7 monoclonal antibody (M06), clone 2G10
Provider product page
Abnova Corporation - H00009441-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CRSP7.
Antigen sequence
GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQS
PPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQ
GNWYDWTQCISLDPHGDDGRLNILPYVCLD
Isotype
IgG
Antibody clone number
2G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -