Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009441-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009441-M06, RRID:AB_1112312
- Product name
- CRSP7 monoclonal antibody (M06), clone 2G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRSP7.
- Antigen sequence
GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQS
PPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQ
GNWYDWTQCISLDPHGDDGRLNILPYVCLD- Isotype
- IgG
- Antibody clone number
- 2G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CRSP7 expression in transfected 293T cell line by CRSP7 monoclonal antibody (M06), clone 2G10.Lane 1: CRSP7 transfected lysate(65.446 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MED26 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol