HPA071835

MED26 antibody from Atlas Antibodies
CRSP7, CRSP70

Antibody data

Product number
HPA071835
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA071835, RRID:AB_2686455
Product name
Anti-MED26
Provider product page
Atlas Antibodies - HPA071835
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVC
WLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPD
SS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -