SAB1400344

MED26 antibody from Sigma-Aldrich
CRSP7, CRSP70
ELISA
Recommended by provider

Antibody data

Product number
SAB1400344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400344, RRID:AB_1840981
Product name
Monoclonal Anti-CRSP7 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400344
Antibody type
Monoclonal
Antigen
CRSP7 (NP_004822, a.a. 501-601) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQS
PPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQ
GNWYDWTQCISLDPHGDDGRLNILPYVCLD* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -