H00008555-B01P

CDC14B antibody from Abnova Corporation
Cdc14B1, Cdc14B2, CDC14B3, hCDC14B

Antibody data

Product number
H00008555-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008555-B01P, RRID:AB_1572389
Product name
CDC14B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008555-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CDC14B protein.
Antigen sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSST
QQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASN
VHYFSIDNELEYENFYADFGPLNLAMVYRYCCKIN
KKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYM
VIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNF
YITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEK
AENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSP
ETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDH
HDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCK
AGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG
SVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQ
HRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQA
VTFLDRLLIWLGIHKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -