Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040648 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040648, RRID:AB_10795635
- Product name
- Anti-TFAM
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKP
VSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRW
RELPDSKK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells.
Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE, Salem AF, Tsirigos A, Lamb R, Sneddon S, Hulit J, Howell A, Lisanti MP
Cell cycle (Georgetown, Tex.) 2012 Dec 1;11(23):4390-401
Cell cycle (Georgetown, Tex.) 2012 Dec 1;11(23):4390-401
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines Caco-2 and HeLa using Anti-TFAM antibody. Corresponding TFAM RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-TFAM antibody HPA040648 (A) shows similar pattern to independent antibody HPA063684 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong cytoplasmic positivity in granular pattern in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in a subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN