Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007019-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007019-D01P, RRID:AB_1715621
- Product name
- TFAM purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human TFAM protein.
- Antigen sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSF
VYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRA
EWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKG
DSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEE
C- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Melatonin blunts the mitochondrial/NLRP3 connection and protects against radiation-induced oral mucositis.
Estradiol and tamoxifen regulate NRF-1 and mitochondrial function in mouse mammary gland and uterus.
Ortiz F, Acuña-Castroviejo D, Doerrier C, Dayoub JC, López LC, Venegas C, García JA, López A, Volt H, Luna-Sánchez M, Escames G
Journal of pineal research 2015 Jan;58(1):34-49
Journal of pineal research 2015 Jan;58(1):34-49
Estradiol and tamoxifen regulate NRF-1 and mitochondrial function in mouse mammary gland and uterus.
Ivanova MM, Radde BN, Son J, Mehta FF, Chung SH, Klinge CM
Journal of molecular endocrinology 2013 Oct;51(2):233-46
Journal of molecular endocrinology 2013 Oct;51(2):233-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T01) by TFAM MaxPab polyclonal antibody.Lane 1: TFAM transfected lysate(29.10 KDa).Lane 2: Non-transfected lysate.