Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007019-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007019-B01P, RRID:AB_10717875
- Product name
- TFAM purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human TFAM protein.
- Antigen sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSF
VYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRA
EWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKG
DSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEE
C- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells.
Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells.
Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair.
Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA and inflammatory factors.
Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion.
Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes.
Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane.
Akbari M, Sykora P, Bohr VA
Scientific reports 2015 Aug 10;5:12876
Scientific reports 2015 Aug 10;5:12876
Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells.
Gibellini L, Pinti M, Boraldi F, Giorgio V, Bernardi P, Bartolomeo R, Nasi M, De Biasi S, Missiroli S, Carnevale G, Losi L, Tesei A, Pinton P, Quaglino D, Cossarizza A
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Dec;28(12):5122-35
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Dec;28(12):5122-35
Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair.
Akbari M, Keijzers G, Maynard S, Scheibye-Knudsen M, Desler C, Hickson ID, Bohr VA
DNA repair 2014 Apr;16:44-53
DNA repair 2014 Apr;16:44-53
Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA and inflammatory factors.
Gispert S, Parganlija D, Klinkenberg M, Dröse S, Wittig I, Mittelbronn M, Grzmil P, Koob S, Hamann A, Walter M, Büchel F, Adler T, Hrabé de Angelis M, Busch DH, Zell A, Reichert AS, Brandt U, Osiewacz HD, Jendrach M, Auburger G
Human molecular genetics 2013 Dec 15;22(24):4871-87
Human molecular genetics 2013 Dec 15;22(24):4871-87
Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion.
Rolland SG, Motori E, Memar N, Hench J, Frank S, Winklhofer KF, Conradt B
Proceedings of the National Academy of Sciences of the United States of America 2013 Aug 6;110(32):E2967-76
Proceedings of the National Academy of Sciences of the United States of America 2013 Aug 6;110(32):E2967-76
Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes.
Holmström MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E731-9
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E731-9
Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane.
Aamann MD, Sorensen MM, Hvitby C, Berquist BR, Muftuoglu M, Tian J, de Souza-Pinto NC, Scheibye-Knudsen M, Wilson DM 3rd, Stevnsner T, Bohr VA
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jul;24(7):2334-46
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jul;24(7):2334-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAM MaxPab polyclonal antibody. Western Blot analysis of TFAM expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T02) by TFAM MaxPab polyclonal antibody.Lane 1: TFAM transfected lysate(27.06 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to TFAM on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of purified MaxPab antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
