Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007019-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007019-D01, RRID:AB_10717737
- Product name
- TFAM MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human TFAM protein.
- Antigen sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSF
VYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRA
EWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKG
DSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEE
C- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ropinirole protects against 1-methyl-4-phenyl-1, 2, 3, 6-tetrahydropyridine (MPTP)-induced neurotoxicity in mice via anti-apoptotic mechanism.
Skeletal muscle growth hormone receptor signaling regulates basal, but not fasting-induced, lipid oxidation.
Park G, Park YJ, Yang HO, Oh MS
Pharmacology, biochemistry, and behavior 2013 Mar;104:163-8
Pharmacology, biochemistry, and behavior 2013 Mar;104:163-8
Skeletal muscle growth hormone receptor signaling regulates basal, but not fasting-induced, lipid oxidation.
Vijayakumar A, Wu Y, Buffin NJ, Li X, Sun H, Gordon RE, Yakar S, LeRoith D
PloS one 2012;7(9):e44777
PloS one 2012;7(9):e44777
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T02) by TFAM MaxPab polyclonal antibody.Lane 1: TFAM transfected lysate(29.10 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TFAM transfected lysate using anti-TFAM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TFAM purified MaxPab mouse polyclonal antibody (B01P) (H00007019-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol