Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182357 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor A, Mitochondrial (TFAM) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQV
YKEEI SRFKEQLTPS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation.
Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms.
Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption.
ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.
Urea cycle gene expression is suppressed by PFOA treatment in rats.
Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats.
Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells.
Teodoro JS, Duarte FV, Gomes AP, Varela AT, Peixoto FM, Rolo AP, Palmeira CM
Mitochondrion 2013 Nov;13(6):637-46
Mitochondrion 2013 Nov;13(6):637-46
Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms.
Kemper MF, Zhao Y, Duckles SP, Krause DN
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2013 Jan;33(1):122-8
Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2013 Jan;33(1):122-8
Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption.
Miyazaki T, Iwasawa M, Nakashima T, Mori S, Shigemoto K, Nakamura H, Katagiri H, Takayanagi H, Tanaka S
The Journal of biological chemistry 2012 Nov 2;287(45):37808-23
The Journal of biological chemistry 2012 Nov 2;287(45):37808-23
ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.
Lu W, Chen Z, Zhang H, Wang Y, Luo Y, Huang P
Cell death & disease 2012 Nov 15;3:e422
Cell death & disease 2012 Nov 15;3:e422
Urea cycle gene expression is suppressed by PFOA treatment in rats.
Walters MW, Wallace KB
Toxicology letters 2010 Aug 1;197(1):46-50
Toxicology letters 2010 Aug 1;197(1):46-50
Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats.
Walters MW, Bjork JA, Wallace KB
Toxicology 2009 Oct 1;264(1-2):10-5
Toxicology 2009 Oct 1;264(1-2):10-5
Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells.
Shi X, Burkart A, Nicoloro SM, Czech MP, Straubhaar J, Corvera S
The Journal of biological chemistry 2008 Nov 7;283(45):30658-67
The Journal of biological chemistry 2008 Nov 7;283(45):30658-67
No comments: Submit comment
No validations: Submit validation data