HPA048738

SERPING1 antibody from Atlas Antibodies
C1-INH, C1IN, C1INH, C1NH, HAE1, HAE2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA048738
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA048738, RRID:AB_2680505
Product name
Anti-SERPING1
Provider product page
Atlas Antibodies - HPA048738
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLV
ILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKF
QPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLN
LCGLTED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -