HPA011361

CDC5L antibody from Atlas Antibodies
CDC5, CEF1, hCDC5, PCDC5RP

Antibody data

Product number
HPA011361
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011361, RRID:AB_1846379
Product name
Anti-CDC5L
Provider product page
Atlas Antibodies - HPA011361
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPE
DGMADYSDPSYVKQMERESREHLRLGLLGLPAPKN
DFEIVLPENAEKELEEREIDDTYIEDAADVDARKQ
AIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.