HPA011361

CDC5L antibody from Sigma-Aldrich
CDC5, CEF1, hCDC5, PCDC5RP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011361
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011361, RRID:AB_1846379
Product name
Anti-CDC5L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011361
Antibody type
Polyclonal
Antigen
Cell division cycle 5-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPE
DGMADYSDPSYVKQMERESREHLRLGLLGLPAPKN
DFEIVLPENAEKELEEREIDDTYIEDAADVDARKQ
AIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
Storage
-20C
Provider Type Product Number
- No reagents -