Antibody data

Product number
H00023394-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023394-M02, RRID:AB_10720048
Product name
ADNP monoclonal antibody (M02), clone 2C5
Provider product page
Abnova Corporation - H00023394-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ADNP.
Antigen sequence
TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASE
NDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEP
MHGSLAGVKLSSQQA
Isotype
IgG
Antibody clone number
2C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -