HPA006371

ADNP antibody from Atlas Antibodies
ADNP1, KIAA0784
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006371
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006371, RRID:AB_1078105
Product name
Anti-ADNP
Provider product page
Atlas Antibodies - HPA006371
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASES
EEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVD
QDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKP
GTWSDESSQSEDARSSKPAAKKKATMQGDREQLKW
KNSSYGKVEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -